Phage Therapy (Biocontrol*): Light and Shade Visit new site : Sellanophagetherapy.blogspot.com: Crystal Structure Of Lysin B From Mycobacteriophage D29.

"In silico"

From Wikipedia
If the target host* of a phage therapy treatment is not an animal the term "biocontrol" (as in phage-mediated biocontrol of bacteria) is usually employed, rather than "phage therapy".

In silico
From:"Genomics,Proteomics and Clinical Bacteriology",N.Woodford and Alan P.Johnson

Phrase that emphasizes the fact that many molecular biologists spend increasing amounts of their time in front of a computer screen, generating hypotheses that can subsequently be tested and (hopefully) confirmed in the laboratory.

Sunday 31 January 2010

Crystal Structure Of Lysin B From Mycobacteriophage D29.

From NCBI links:

1
2
3
4

primary structure gp 12 protein (254 Aa) :

MSKPWLFTVHGTGQPDPLGPGLPADTARDVLDIYRWQPIGNYPAAAFP
MWPSVEKGVAELILQIELKLDADPYADFAMAGYSQGAIVVGQVLKHHIL
PPTGRLHRFLHRLKKVIFWGNPMRQKGFAHSDEWIHPVAAPDTLGILED
RLENLEQYGFEVRDYAHDGDMYASIKEDDLHEYEVAIGRIVMKASGFIG
GRDSVVAQLIELGQRPITEGIALAGAIIDALTFFARSRMGDKWPHLYNRY
PAVEFLRQI

By RasWin:

By VMD 1.8.7:

Got to last post

E	Enterococcus faecium	Third most common cause of HCA BSI. Increasing resistance to vancomycin.
S	Staphylococcus aureus (MRSA)	Emerging resistance to current drugs and significant drug toxicities. Lack of oral agents for step-down therapy
K	Klebsiella Escherichia coli K pneumoniae	ESBL-producing organisms increasing in frequency and severity; associated with increasing mortality. K pneumoniae carbapenemases causing severe infections in LTCF. Few active agents; nothing in development
A	Acinetobacter baumannii	Increasing worldwide, recent surge reported in hospitals. Very high mortality. Carbapenem-resistant.
P	Pseudomonas aeruginosa	Increasing P. aeruginosa infections in US and worldwide. Resistant to carbapenems, quinolones, aminoglycosides
E	Enterobacter species	MDR HCA infections increasing; resistance via ESBLs, carbapenemases, and cephalosporinases

E	Enterococcus faecium
S	Staphylococcus aureus (MRSA)	+
K	Klebsiella Escherichia coli K pneumoniae
A	Acinetobacter baumannii	+
P	Pseudomonas aeruginosa	++
E	Enterobacter species

Phage Therapy (Biocontrol*): Light and Shade Visit new site : Sellanophagetherapy.blogspot.com

messaggio

New site clik on the image

"In silico"

Phage Therapy is influenced by:

Sunday 31 January 2010

Crystal Structure Of Lysin B From Mycobacteriophage D29.