messaggio
clik on the image and visit the new site
"In silico"
From Wikipedia
If the target host* of a phage therapy treatment is not an animal the term "biocontrol" (as in phage-mediated biocontrol of bacteria) is usually employed, rather than "phage therapy".
In silico
From:"Genomics,Proteomics and Clinical Bacteriology",N.Woodford and Alan P.Johnson
Phrase that emphasizes the fact that many molecular biologists spend increasing amounts of their time in front of a computer screen, generating hypotheses that can subsequently be tested and (hopefully) confirmed in the laboratory.
Phage Therapy is influenced by:
Phage therapy is influenced by:
Country : the epidemiological situation is different from country to country in terms of circulating bacteria and bacteriophages. Example: lytic phages from Italy may be no active on the same bacteria (genus and species) isolated from another country and vice versa.
Temporariness
Mutation rate
Phenotypical delay
Phage cocktail
My point of view
Country : the epidemiological situation is different from country to country in terms of circulating bacteria and bacteriophages. Example: lytic phages from Italy may be no active on the same bacteria (genus and species) isolated from another country and vice versa.
Temporariness
Mutation rate
Phenotypical delay
Phage cocktail
My point of view
Wednesday, 10 March 2010
RNA messenger from M.ulcerans and M.marinum In silico analisys
By way of an example I have compared only one cds, the cds 3, of M.marinum and M.ulcerans genome.
Global (Needleman-Wunsch) comparison between:
Protein: 118615923 of cds_3 from Mycobacterium ulcerans Agy99
Protein: 183980039 of cds_3 from Mycobacterium marinum M
Generated: Wed Mar 10 22:33:19 CET 2010
Score: 1232
VNGDGEQPGPGDGAARDELPSMDLVRRTLAEARAAARARGQDPGRGFAAG
VSDDGEQPGPGDGAARDELSGMDLVRRTLAEARAAARARGQDPGRGFAAG
PAPRRVAGRRRSWSGPGPDTRDPQPLGKLTRDLAKKRGWSGHVAEGTVLG
PAPRRVAGRRRSWSGPGPDTRDPQPLGKLTRDLAKKRGWSGHVAEGTVLG
QWSQVVGAQIADHATPTALNEGVLSVTAESTAWATQLRIMQSQLLAKIAA
QWSRVVGAQIADHATPTALNEGVLSVTAESTAWATQLRIMQSQLLAKIAA
AVGNGVVTSLKITGPASPSWRKGPRHIAGRGPRDTYG
AVGNGVVTSLKITGPASPSWRKGPRHIAGRGPRDTYG
Percentage Identity = 97,3%
Cds 3 DNA Dot plot
Cds 3 Protein Dot plot
Cds 3 RNA m (secondary structure)