messaggio

clik on the image and visit the new site

New site clik on the image

New site clik on the image

"In silico"


 From Wikipedia
If the target host* of a phage therapy treatment is not an animal the term "biocontrol" (as in phage-mediated biocontrol of bacteria) is usually employed, rather than "phage therapy".

In silico
From:"Genomics,Proteomics and Clinical Bacteriology",N.Woodford and Alan P.Johnson

Phrase that emphasizes the fact that many molecular biologists spend increasing amounts of their time in front of a computer screen, generating hypotheses that can subsequently be tested and (hopefully) confirmed in the laboratory.


Phage Therapy is influenced by:

Phage therapy is influenced by:

Country : the epidemiological situation is different from country to country in terms of circulating bacteria and bacteriophages. Example: lytic phages from Italy may be no active on the same bacteria (genus and species) isolated from another country and vice versa.
Temporariness
 Mutation rate
Phenotypical delay
Phage cocktail

My point of view

Wednesday 10 March 2010

RNA messenger from M.ulcerans and M.marinum In silico analisys



By way of an example I have compared only one cds, the cds 3, of M.marinum and M.ulcerans genome.




Global (Needleman-Wunsch) comparison between:
Protein: 118615923 of cds_3 from Mycobacterium ulcerans Agy99
Protein: 183980039 of cds_3 from Mycobacterium marinum M
Generated: Wed Mar 10 22:33:19 CET 2010

Score: 1232

VNGDGEQPGPGDGAARDELPSMDLVRRTLAEARAAARARGQDPGRGFAAG
VSDDGEQPGPGDGAARDELSGMDLVRRTLAEARAAARARGQDPGRGFAAG

PAPRRVAGRRRSWSGPGPDTRDPQPLGKLTRDLAKKRGWSGHVAEGTVLG
PAPRRVAGRRRSWSGPGPDTRDPQPLGKLTRDLAKKRGWSGHVAEGTVLG

QWSQVVGAQIADHATPTALNEGVLSVTAESTAWATQLRIMQSQLLAKIAA
QWSRVVGAQIADHATPTALNEGVLSVTAESTAWATQLRIMQSQLLAKIAA

AVGNGVVTSLKITGPASPSWRKGPRHIAGRGPRDTYG
AVGNGVVTSLKITGPASPSWRKGPRHIAGRGPRDTYG


Percentage Identity = 97,3%




Cds 3 DNA Dot plot
Cds 3 Protein Dot plot














Cds 3 RNA m (secondary structure)
Posted by Rodolfo Berretti at 23:08
Labels: