messaggio

clik on the image and visit the new site

New site clik on the image

"In silico"


From Wikipedia
If the target host* of a phage therapy treatment is not an animal the term "biocontrol" (as in phage-mediated biocontrol of bacteria) is usually employed, rather than "phage therapy".

In silico
From:"Genomics,Proteomics and Clinical Bacteriology",N.Woodford and Alan P.Johnson

Phrase that emphasizes the fact that many molecular biologists spend increasing amounts of their time in front of a computer screen, generating hypotheses that can subsequently be tested and (hopefully) confirmed in the laboratory.


Phage Therapy is influenced by:

Phage therapy is influenced by:

Country : the epidemiological situation is different from country to country in terms of circulating bacteria and bacteriophages. Example: lytic phages from Italy may be no active on the same bacteria (genus and species) isolated from another country and vice versa.
Temporariness
Mutation rate
Phenotypical delay
Phage cocktail

My point of view

Wednesday, 12 August 2009

Fasta codes and Integrase gene of Mycobacterium phage D29. Step 4

The nucleic acid codes supported are:


A --> adenosine
C --> cytidine
G --> guanine
T --> thymidine
U --> uridine
R --> G A (purine)
Y --> T C (pyrimidine)
K --> G T (keto)
M --> A C (amino)
S --> G C (strong)
W --> A T (weak)
B --> G T C
D --> G A T
H --> A C T
V --> G C A
N --> A G C T (any)
- gap of indeterminate length


For those programs that use amino acid query sequences
(BLASTP and TBLASTN), the accepted amino acid codes are:
  
A alanine
B aspartate or asparagine
C cystine
D aspartate
E glutamate
F phenylalanine
G glycine
H histidine
I isoleucine
K lysine
L leucine
M methionine
N asparagine
P proline
Q glutamine
R arginine
S serine
T threonine
U selenocysteine
V valine
W tryptophan
Y tyrosine
Z glutamate or glutamine
X any
* translation stop
- gap of indeterminate length


>sp|Q38361|VINT_BPMD2 Integrase OS=Mycobacterium phage D29 GN=33 PE=3 SV=1


MDAEAWLASEKRLIDNEEWTPPAEREKKAAASAITVEEYTKKWIAERD
LAGGTKDLYSTH
ARKRIYPVLGDTPVAEMTPALVRAWWAGMGKQYP
TARRHAYNVLRAVMNTAVEDKLVSEN
PCRIEQKAPAERDVEALTPEEL
DVVAGEVFEHYRVAVYILAWTSLRFGELIEIRRKDIVD
DGETMKLRVR
RGAARVGEKIVVGNTKTVRSKRPVTVPPHVAAMIREHMADRTKMNK
GPEA
LLVTTTRGQRLSKSAFTRSLKKGYAKIGRPDLRIHDLRAVGATL
AAQAGATTKELMVRLG
HTTPRMAMKYQMASAARDEEIARRMSELAGI
TP


The sequence is one amino acid sequence because the amino acid P Proline is presents here. There is not P in the list of nucleic acid codes .

First amino acid in the Integrase sequence is M and the codon in mRNA is the start codon:
AUG.